La biotecnologia il Co., srl di Shenzhen Haiwen è una fabbricazione di polvere cruda degli steroidi, di oli semilavorati, di liquido finito, di HGH, di peptidi e di DROGHE ANESTETICHE LOCALI in Cina.

Sales & Support
Richiedere un preventivo -
Select Language
Casa
Prodotti
Chi siamo
Fatory Tour
Controllo di qualità
Contattaci
Richiedere un preventivo
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
CasaProdottiPolvere di crescita dei capelli

Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial

Ho ricevuto i miei prodotti, l'imballaggio siete fate discreto e perfezionate, realmente mi avete stupito che .i ordinerà appena possibile più voi. Tks!

—— Robet--Australia

Ho cooperato con voi per molte volte, la vostra qualità del prodotto sono così grande, ecco perché io ancora compro i prodotti voi. grazie

—— Richard---American

Ciao il compagno, il vostro migliore prezzo ed il prodotto di elevata purezza è così competitivi nel mio paese, questo mi hanno lasciato realizzare molto profitto, i miei clienti sono realmente come .tks

—— Johnson---Canada

Sono ora online in chat

Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial

Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial fornitore Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial fornitore

Grande immagine :  Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial

Dettagli:

Luogo di origine:La Cina
Marca:SMQ
Certificazione:USP,SGS
Numero di modello:86168-78-7

Termini di pagamento e spedizione:

Quantità di ordine minimo:1kg
Prezzo:USD 10g
Imballaggi particolari:avete richiesto
Tempi di consegna:1-3 giorno
Termini di pagamento:Western Union, Moneygram, T/T
Capacità di alimentazione:1000kg/week
Descrizione di prodotto dettagliata
nome: Sermorelin Formula: C149H246N44O42S
Applicazione: Tamburo del peptide Aspetto: polvere liofilizzata
Skype: nicole0918 Posta elettronica: 2355935183@ycphar.com

Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial

 

 

Dettaglio rapido:


Nome di prodotto: Sermorelin
Sinonimi: SERMORELIN; ACETATO DI SERMORELIN; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; ESSERE UMANO TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; FATTORE DI LIBERAZIONE DELL'ORMONE DELLA CRESCITA (1-29), AMIDE, UMANO; AMIDE DI GRF (1-29) (UMANO)
CAS: 86168-78-7
MF: C149H246N44O42S
Mw: 3357,88
Categorie di prodotto: Derivati dell'aminoacido; Peptide; Ricerca GH-RHObesity; GH-RHPeptides per biologia cellulare; Ormone della crescita che rilascia i fattori; Neuropeptidi; Neurotrasmissione (obesità); Rilasciare i fattori
Uso: inibitore della xantina ossidasi

 
Imballaggio & processo di consegna:
 
1. Consegna: I pacchetti sarebbero sistemati in 12 ore sopra la ricevuta il vostro pagamento.
2. Imballaggio: Le polveri degli steroidi sarebbero imballate abbastanza discreto per attraversare le abitudini
3. universalmente sicuro. Imballando come l'alimento del cinese tradizionale, oggetti di bagno e di lavaggio ed altri attrezzature, ecc…
4. Servizio extra: Le foto del pacchetto sarebbero fornite affinchè distinguano gli steroidi.
il numero 5.Tracking sarebbe offerto una volta che è liberato.
servizio 6.After-sale: Tutte le domande dopo che avete ottenuto il pacchetto, ci contattano prego per la prima volta. I problemi sarebbero risolti immediatamente per voi.
 
Vantaggio competitivo:
 

  1. Esperienza ricca di carico della quantità grande di contenitori nel porto marittimo cinese;
  2. Spedizione veloce dalla linea marittima ben-reputata;
  3. Imballando con i pallet secondo la richiesta speciale dei compratori;
  4. Fornitura del servizio migliore dopo la spedizione dal email;
  5. Carichi insieme a servizio di vendite del contenitore disponibile;
  6. Fornitura delle foto dei carichi prima e dopo caricamento nel contenitore;
  7. Materie prime dall'origine cinese;

 

Prodotti relativi:

 

Serie del polipeptide

 Nome di prodotto

Specificazione

MGF

2mg/vial

MGF DEL PIOLO

2mg/vial

CJC-1295 con DAC

2mg/vial

CJC-1295 senza DAC

2mg/vial

PT-141

10mg/vial

MT-1

10mg/vial

MT-2

10mg/vial

GHRP-2

10mg/vial

GHRP-2

5mg/vial

GHRP-6

10mg/vial

GHRP-6

5mg/vial

Ipamorelin

2mg/vial

Hexarelin

2mg/vial

Sermorelin

2mg/vial

Ossitocina

2mg/vial

 TB500

2mg/vial

pentadecapeptide BPC 157

2mg/vial

HGH 176-191

2mg/vial

Triptorelina2mg/vial
Tesamorelin2mg/vial
Gonadorelina2mg/vial
Gonadorelina10mg/vial
DSIP2mg/vial
Selank5mg/vial

 

 

 
 
Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial

Dettagli di contatto
Shenzhen Haiwen Biotechnology Co.,Ltd

Persona di contatto: Mrs. Lisa

Invia la tua richiesta direttamente a noi (0 / 3000)

Altri prodotti

99,5% polvere CAS farmaceutico 38304-91-5 di crescita dei capelli di Minoxidil USP34 di elevata purezza

Polvere Avodart/Dutasteride 164656-23-9 Duagen di crescita dei capelli di BPH

Liofilizzato inietti il polipeptide steroide di Sermorelin della crescita dei capelli 2mg/vial

Polvere orale CAS cristallino bianco 98319-26-7 di crescita dei capelli di Hongdenafil

Acetato steroide PT141 CAS 32780-32-8 del peptide di crescita afrodisiaca dei capelli bianchi

Steroidi dell'Anti-estrogeno di Dutasteride Avodart della polvere di crescita dei capelli di salute 99%

Steroidi steroidi dell'Anti-estrogeno di Finasteride Proscar di crescita solida cristallina bianca dei capelli